PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK22178.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 236aa    MW: 26921.1 Da    PI: 4.3244
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK22178.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13e-161958647
                     HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     + E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
        PK22178.1 19 EAEEQLVIDLHARLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 58
                     67***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-16367IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-24464IPR009057Homeodomain-like
PROSITE profilePS5129426.642963IPR017930Myb domain
SMARTSM007172.1E-141361IPR001005SANT/Myb domain
CDDcd001678.02E-111859No hitNo description
PfamPF002492.7E-141958IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
XLRWTNYLRP DLKRGLLNEA EEQLVIDLHA RLGNRWSKIA AKLPGRTDNE IKNHWNTHIK  60
KKLVKMGIDP VTHEPLNNNN NDNSIIPNEE IIKPCTATTT NNSIDQKTEE EEEEEQEKGI  120
IDQPKSNKSI KTENSSSTDN ESSQPSDLIN MYDHDPLMSY LLSENFLIED SSSWDFPEAT  180
TTTTTTSTTT ADNYSDHNNH FGVYSSSSSE ETSTWLLESN KDLLGDDGEL WAWFLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-1636348108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010101097.12e-64Protein ODORANT1
SwissprotQ50EX61e-48ODO1_PETHY; Protein ODORANT1
TrEMBLW9RQ263e-64W9RQ26_9R
STRINGPOPTR_0015s14600.11e-52(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.16e-43myb domain protein 42